Back to News
Market Impact: 0.6

Here are Monday's biggest analyst calls: Nvidia, Tesla, Netflix, Amazon, Estee Lauder, AMD, DoorDash, Penn & more

JPMAMZNGSTSNHRLDBELWYNNPENNWFCFMCMARNVDAMSMCEVRAMDRJFDASHTSLABMODOWCBACNFLXHHH
Analyst InsightsCompany FundamentalsCorporate EarningsCorporate Guidance & OutlookTechnology & InnovationM&A & RestructuringCapital Returns (Dividends / Buybacks)Consumer Demand & Retail
Here are Monday's biggest analyst calls: Nvidia, Tesla, Netflix, Amazon, Estee Lauder, AMD, DoorDash, Penn & more

Wall Street analysts issued a flurry of ratings on Monday, reflecting varied sentiment across numerous sectors. Several firms, including JPMorgan, Goldman Sachs, and Deutsche Bank, made bullish calls, initiating or upgrading companies in e-commerce, food, beauty, gaming, and tech, often citing strong demand, growth optionality, or attractive entry points. Conversely, some downgrades occurred, such as BMO's on Dow due to softer pricing and JPMorgan's on Howard Hughes over strategic concerns, highlighting specific industry headwinds or strategic skepticism. This activity underscores a nuanced outlook driven by company-specific catalysts and broader market trends.

Analysis

A broad-based but selective bullish sentiment is evident from recent Wall Street analyst calls, highlighting specific corporate catalysts over macroeconomic momentum. In technology, JPMorgan reiterated Amazon as its 'best idea' with a $240 price target based on a 2026 free cash flow forecast of $75 billion, while Rothschild and Wedbush expressed confidence in Nvidia's AI leadership and Tesla's robotaxi technology, respectively. Cyclical recovery themes are also prominent, with Goldman Sachs initiating buy ratings on Tyson Foods and Hormel due to strong protein demand, and Wells Fargo upgrading FMC Corporation on the belief that 2024 will mark an earnings bottom. Similarly, Deutsche Bank upgraded Estee Lauder, citing evidence of a bottom in beauty demand and successful geographic diversification. The financial sector saw positive revisions, as Morgan Stanley upgraded Moelis & Co and Evercore on expectations of a record deal pipeline and raised price targets for Bank of America and Citigroup, anticipating a rebound in M&A and equity capital markets. In contrast, specific headwinds are also noted, with BMO downgrading Dow Inc. to underperform due to soft pricing and JPMorgan moving Howard Hughes to neutral on skepticism regarding its strategic pivot away from real estate.

AllMind AI Terminal

AI-powered research, real-time alerts, and portfolio analytics for institutional investors.