Back to News
Market Impact: 0.25

Wedbush Says 2026 Is the "Inflection Year" for Artificial Intelligence (AI). Here's the Stock to Own.

CRWDMSFTAAPLTSLAPLTRNVDAINTCSNFLXNDAQ
Cybersecurity & Data PrivacyArtificial IntelligenceTechnology & InnovationCompany FundamentalsAnalyst InsightsProduct LaunchesCorporate Guidance & OutlookInvestor Sentiment & Positioning
Wedbush Says 2026 Is the "Inflection Year" for Artificial Intelligence (AI). Here's the Stock to Own.

CrowdStrike is presented as a compelling buy: revenue grew at a 41% CAGR from fiscal 2021–2026 and analysts forecast a 22% CAGR from fiscal 2026–2029 with profitability expected in fiscal 2027. The company has >29,000 enterprise customers, its market cap is $103.7B and the stock trades at ~14x next-year sales; 50% of customers used at least six modules at end of fiscal 2026 (up from 24% in 2021). Key growth drivers cited are its cloud-native Falcon platform, expanded AI features and modular ecosystem, and the Falcon Flex consumption-based plan to capture more customers.

Analysis

CrowdStrike’s recent product and pricing moves should be read as a two-way lever: they both deepen account monetization and materially change revenue predictability. A migration from fixed subscriptions toward consumption economics can raise customer lifetime value if conversion to recurring contracts follows, but in the near term it makes top-line lumpy and more sensitive to usage shocks (macroeconomic or event-driven). That volatility is underappreciated by the market and is the primary execution risk to the current multiple. Second-order winners include hyperscalers and GPU vendors because richer telemetry and AI inference on telemetry drive incremental cloud compute and accelerator demand; expect incremental ARR to translate into measurable cloud spend per enterprise over 12–24 months. Conversely, small specialist vendors that compete on pure-agent performance without a bundled platform are likely to face margin pressure and channel squeeze as large customers prefer consolidated suppliers and integrated analytics stacks. The critical catalysts are (1) conversion rates from consumption customers back to contracts (12–18 months), (2) a sequence of large enterprise renewals or major outages, and (3) transparency on gross margin impact from AI compute and reduced equity comp. Short-term macro shocks or a high-visibility outage could compress multiples quickly; sustained execution on conversion and margin cadence is needed to re-rate the name over 12–36 months.